NKAIN4 Antikörper (N-Term)

Produktnummer ABIN636103

Produktdetails anti-NKAIN4 Antikörper

Target: NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NKAIN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NKAIN4 antibody was raised against the N terminal of NKAIN4

Aufreinigung: Affinity purified

Immunogen: NKAIN4 antibody was raised using the N terminal of NKAIN4 corresponding to a region with amino acids MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NKAIN4 Blocking Peptide, catalog no. 33R-6073, is also available for use as a blocking control in assays to test for specificity of this NKAIN4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NKAIN4

Target: NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))

Andere Bezeichnung: NKAIN4 (NKAIN4 Produkte)

Synonyme: zgc:172210 antikoerper, C20orf58 antikoerper, FAM77A antikoerper, bA261N11.2 antikoerper, AB030182 antikoerper, C030019F02Rik antikoerper, RGD1305809 antikoerper, sodium/potassium transporting ATPase interacting 4 antikoerper, Na+/K+ transporting ATPase interacting 4 antikoerper, Sodium/potassium transporting ATPase interacting 4 antikoerper, sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 antikoerper, nkain4 antikoerper, NKAIN4 antikoerper, Nkain4 antikoerper

Hintergrund: The specific function of NKAIN4 is not yet known.

Molekulargewicht: 23 kDa (MW of target protein)