UGT2B15 Antikörper (N-Term)

Produktnummer ABIN636105

Produktdetails anti-UGT2B15 Antikörper

Target: UGT2B15 (UDP Glucuronosyltransferase 2 Family, Polypeptide B15 (UGT2B15))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT2B15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT2 B15 antibody was raised against the N terminal of µgT2 15

Aufreinigung: Affinity purified

Immunogen: UGT2 B15 antibody was raised using the N terminal of µgT2 15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT2B15 Blocking Peptide, catalog no. 33R-4025, is also available for use as a blocking control in assays to test for specificity of this µgT2B15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT2B15

Target: UGT2B15 (UDP Glucuronosyltransferase 2 Family, Polypeptide B15 (UGT2B15))

Andere Bezeichnung: UGT2B15 (UGT2B15 Produkte)

Synonyme: UGT2B28 antikoerper, HLUG4 antikoerper, UDPGT 2B8 antikoerper, UDPGT2B15 antikoerper, UDPGTH3 antikoerper, UGT2B8 antikoerper, UDP-glucuronosyltransferase 2B15 antikoerper, UDP glucuronosyltransferase family 2 member B15 antikoerper, LOC461289 antikoerper, LOC100591991 antikoerper, UGT2B15 antikoerper

Hintergrund: The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis