CYB561 Antikörper (Middle Region)
-
- Target Alle CYB561 Antikörper anzeigen
- CYB561 (Cytochrome B-561 (CYB561))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYB561 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYB561 antibody was raised against the middle region of CYB561
- Aufreinigung
- Affinity purified
- Immunogen
- CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA
- Top Product
- Discover our top product CYB561 Primärantikörper
-
anti-Cytochrome B-561 (CYB561) antibody
CYB561 Reaktivität: Human, Maus WB, IP, ICC Wirt: Maus Monoclonal unconjugated
anti-Cytochrome B-561 (CYB561) antibodyCYB561 Reaktivität: Ratte IF, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-561 (CYB561) (AA 144-193) antibodyCYB561 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Rind (Kuh), Hund, Pferd, Kaninchen, Schaf, Schwein, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-561 (CYB561) (C-Term) antibodyCYB561 Reaktivität: Human, Maus, Ratte, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-561 (CYB561) (AA 72-121) antibodyCYB561 Reaktivität: Human, Meerschweinchen, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-561 (CYB561) (Middle Region) antibodyCYB561 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Rind (Kuh), Hund, Pferd, Kaninchen, Schaf, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-561 (CYB561) (N-Term) antibodyCYB561 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Rind (Kuh), Hund, Pferd, Kaninchen, Schaf WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYB561 Blocking Peptide, catalog no. 33R-4943, is also available for use as a blocking control in assays to test for specificity of this CYB561 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB561 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYB561 (Cytochrome B-561 (CYB561))
- Andere Bezeichnung
- CYB561 (CYB561 Produkte)
- Synonyme
- CYB561A1 antikoerper, FRRS2 antikoerper, ECK1410 antikoerper, JW5224 antikoerper, MGC69260 antikoerper, zgc:193680 antikoerper, zgc:193701 antikoerper, ACYB-1 antikoerper, MBB18.18 antikoerper, MBB18_18 antikoerper, cytochrome B561-1 antikoerper, xcyt antikoerper, cytochrome b561 antikoerper, cytochrome b-561 antikoerper, cytochrome B561-1 antikoerper, cytochrome b561 L homeolog antikoerper, CYB561 antikoerper, cytb561 antikoerper, cybB antikoerper, LOC5576849 antikoerper, LOC5576850 antikoerper, Cyb561 antikoerper, cyb561 antikoerper, CYB-1 antikoerper, cyb561.L antikoerper, LOC100347599 antikoerper
- Hintergrund
- CYB561 is a senescene-associated protein in normal human oral keratinocytes.
- Molekulargewicht
- 27 kDa (MW of target protein)
-
