SLC19A3 Antikörper (Middle Region)
-
- Target Alle SLC19A3 (Slc19a3) Antikörper anzeigen
- SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC19A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC19 A3 antibody was raised against the middle region of SLC19 3
- Aufreinigung
- Affinity purified
- Immunogen
- SLC19 A3 antibody was raised using the middle region of SLC19 3 corresponding to a region with amino acids FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY
- Top Product
- Discover our top product Slc19a3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC19A3 Blocking Peptide, catalog no. 33R-2848, is also available for use as a blocking control in assays to test for specificity of this SLC19A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))
- Andere Bezeichnung
- SLC19A3 (Slc19a3 Produkte)
- Synonyme
- BBGD antikoerper, THMD2 antikoerper, THTR2 antikoerper, thtr2 antikoerper, MGC52872 antikoerper, MGC89434 antikoerper, si:dkey-223n17.4 antikoerper, slc19a3 antikoerper, A230084E24Rik antikoerper, AI788884 antikoerper, ThTr2 antikoerper, solute carrier family 19 member 3 antikoerper, solute carrier family 19 member 3 L homeolog antikoerper, solute carrier family 19 (thiamine transporter), member 3 antikoerper, thiamine transporter 2 antikoerper, solute carrier family 19 (thiamine transporter), member 3b antikoerper, solute carrier family 19, member 3 antikoerper, thiamine transporter 2-like antikoerper, SLC19A3 antikoerper, Slc19a3 antikoerper, slc19a3.L antikoerper, slc19a3 antikoerper, LOC486151 antikoerper, slc19a3b antikoerper, LOC100230080 antikoerper
- Hintergrund
- SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-