ZPLD1 Antikörper (C-Term)

Produktnummer ABIN636115

Produktdetails anti-ZPLD1 Antikörper

Target: ZPLD1 (Zona Pellucida-Like Domain Containing 1 (ZPLD1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZPLD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZPLD1 antibody was raised against the C terminal of ZPLD1

Aufreinigung: Affinity purified

Immunogen: ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZPLD1 Blocking Peptide, catalog no. 33R-1851, is also available for use as a blocking control in assays to test for specificity of this ZPLD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZPLD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZPLD1

Target: ZPLD1 (Zona Pellucida-Like Domain Containing 1 (ZPLD1))

Andere Bezeichnung: ZPLD1 (ZPLD1 Produkte)

Synonyme: 9430016A21Rik antikoerper, zona pellucida like domain containing 1 antikoerper, si:ch211-229d2.5 antikoerper, zona pellucida-like domain containing 1 S homeolog antikoerper, ZPLD1 antikoerper, si:ch211-229d2.5 antikoerper, zpld1 antikoerper, Zpld1 antikoerper, zpld1.S antikoerper

Hintergrund: The function of ZPLD1 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 47 kDa (MW of target protein)