UGT1A6 Antikörper (C-Term)

Produktnummer ABIN636119

Produktdetails anti-UGT1A6 Antikörper

Target: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT1A6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT1 A6 antibody was raised against the C terminal of µgT1 6

Aufreinigung: Affinity purified

Immunogen: UGT1 A6 antibody was raised using the C terminal of µgT1 6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT1A6 Blocking Peptide, catalog no. 33R-1424, is also available for use as a blocking control in assays to test for specificity of this µgT1A6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT1A6

Target: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Andere Bezeichnung: UGT1A6 (UGT1A6 Produkte)

Hintergrund: UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha