EDAR Antikörper (Middle Region)

Produktnummer ABIN636121

Produktdetails anti-EDAR Antikörper

Target: EDAR (Ectodysplasin A Receptor (EDAR))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EDAR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ectodysplasin A Receptor antibody was raised against the middle region of EDAR

Aufreinigung: Affinity purified

Immunogen: Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ectodysplasin A Receptor Blocking Peptide, catalog no. 33R-6971, is also available for use as a blocking control in assays to test for specificity of this Ectodysplasin A Receptor antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDAR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EDAR

Target: EDAR (Ectodysplasin A Receptor (EDAR))

Andere Bezeichnung: Ectodysplasin A Receptor (EDAR Produkte)

Synonyme: rs3 antikoerper, edar antikoerper, EDAR antikoerper, MGC88893 antikoerper, DL antikoerper, ECTD10A antikoerper, ECTD10B antikoerper, ED1R antikoerper, ED3 antikoerper, ED5 antikoerper, EDA-A1R antikoerper, EDA1R antikoerper, EDA3 antikoerper, HRM1 antikoerper, dl antikoerper, RGD1561714 antikoerper, ectodysplasin A receptor antikoerper, ectodysplasin-A receptor antikoerper, edar antikoerper, EDAR antikoerper, Edar antikoerper

Hintergrund: EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Tube Formation, Ubiquitin Proteasome Pathway