PCDH15 Antikörper

Produktnummer ABIN6719362

Produktdetails anti-PCDH15 Antikörper

Target: PCDH15 (Protocadherin-15 (PCDH15))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDH15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS), Immunohistochemistry (Frozen Sections) (IHC (fro))

Verwendungszweck: Rabbit IgG polyclonal antibody for PCDH15 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Sequenz: DLTVYAIDPQ TNRAIDRNEL FKFLDGKLLD INKDFQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for PCDH15 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human PCDH15(DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Kommentare:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PCDH15

Target: PCDH15 (Protocadherin-15 (PCDH15))

Andere Bezeichnung: PCDH15 (PCDH15 Produkte)

Synonyme: CDHR15 antikoerper, DFNB23 antikoerper, USH1F antikoerper, BB078305 antikoerper, ENSMUSG00000046980 antikoerper, Gm9815 antikoerper, Ush1f antikoerper, av antikoerper, nmf19 antikoerper, protocadherin-15 antikoerper, protocadherin related 15 antikoerper, protocadherin-15 antikoerper, protocadherin 15 antikoerper, PCDH15 antikoerper, CpipJ_CPIJ005081 antikoerper, Pcdh15 antikoerper

Hintergrund:

Synonyms: Protocadherin-15, PCDH15, USH1F

Background: Protocadherin-15 is a protein that in humans is encoded by the PCDH15 gene. This gene is mapped to 10q21.1. This gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts are inferred to occur in human, and additional variants are likely to occur.

Gen-ID: 65217

Pathways: Sensory Perception of Sound