SLC34A2 Antikörper

Produktnummer ABIN6719419

Produktdetails anti-SLC34A2 Antikörper

Target: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC34A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for SLC34A2 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Sequenz: QNWTMKNVTY KENIAKCQHI FVNFHLPDLA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for SLC34A2 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Kommentare:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SLC34A2

Target: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Andere Bezeichnung: SLC34A2 (SLC34A2 Produkte)

Synonyme: SLC34A2 antikoerper, AA536683 antikoerper, D5Ertd227e antikoerper, NaPi-2b antikoerper, Npt2b antikoerper, NAPI-3B antikoerper, NAPI-IIb antikoerper, NPTIIb antikoerper, solute carrier family 34 member 2 antikoerper, solute carrier family 34 (sodium phosphate), member 2 antikoerper, SLC34A2 antikoerper, Slc34a2 antikoerper

Hintergrund:

Synonyms: Sodium-dependent phosphate transport protein 2B, Sodium-phosphate transport protein 2B, Na(+)-dependent phosphate cotransporter 2B, NaPi3b, Sodium/phosphate cotransporter 2B, Na(+)/Pi cotransporter 2B, NaPi-2b, Solute carrier family 34 member 2, SLC34A2

Background: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH -sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH . Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

Gen-ID: 10568

UniProt: O95436