MAP3K1 Antikörper (AA 1077-1176)
-
- Target Alle MAP3K1 Antikörper anzeigen
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
-
Bindungsspezifität
- AA 1077-1176
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser MAP3K1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Formalin-fixed Sections) (IHC (f))
- Spezifität
- Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
- Kreuzreaktivität (Details)
- Human.
- Aufreinigung
- 1.0mg/ml of Ab purified from Bioreactor by Protein A/G.
- Immunogen
- Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
- Klon
- 2F6
- Isotyp
- IgG2a kappa
- Top Product
- Discover our top product MAP3K1 Primärantikörper
-
-
- Applikationshinweise
-
Known_Application: Western Blot (1-2 μg/mL),Immunohistochemistry (Formalin-fixed) (1-2 μg/mL for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10 mM Tris Buffer with 1 mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.
Positive_Control: A431, HeLa or HL-60 cells. Liver tissue.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Konzentration
- 1.0 mg/mL
- Buffer
- Prepared in 10 mM PBS, WITHOUT BSA and Azide.
- Konservierungsmittel
- Azide free
- Lagerung
- -20 °C,-80 °C
- Informationen zur Lagerung
- Antibody without azide store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous.
- Haltbarkeit
- 24 months
-
- Target
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
- Andere Bezeichnung
- MAP3K1 (MAP3K1 Produkte)
- Synonyme
- MAP3K1 antikoerper, Mekk1 antikoerper, MAPKKK1 antikoerper, MEKK1 antikoerper, Mekk antikoerper, ARAKIN antikoerper, ATMEKK1 antikoerper, MAPK/ERK kinase kinase 1 antikoerper, MAPKKK8 antikoerper, T15F16.5 antikoerper, T15F16_5 antikoerper, MEKK antikoerper, MEKK 1 antikoerper, SRXY6 antikoerper, mitogen-activated protein kinase kinase kinase 1 antikoerper, mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase antikoerper, MAPK/ERK kinase kinase 1 antikoerper, MAP3K1 antikoerper, map3k1 antikoerper, Map3k1 antikoerper, MEKK1 antikoerper
- Hintergrund
-
MEKK1, MEK Kinase 1, MEKK, SRXY6, MAPKKK1,MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)
Cellular localisation: Cytoplasmic - Molekulargewicht
- 195kDa (intact), 80kDa (cleaved)
- Gen-ID
- 4214, 653654
- UniProt
- Q13233
- Pathways
- MAPK Signalweg, Interferon-gamma Pathway, Caspase Kaskade in der Apoptose, TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades
-