CLCN3 Antikörper (C-Term, Intracellular)
-
- Target Alle CLCN3 Antikörper anzeigen
- CLCN3 (Chloride Channel 3 (CLCN3))
-
Bindungsspezifität
- AA 592-661, C-Term, Intracellular
-
Reaktivität
- Ratte, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLCN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunoprecipitation (IP)
- Produktmerkmale
- Anti-CLC-3 (CLCN3) Antibody (ABIN7043052, ABIN7044121 and ABIN7044122)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize CLC-3 from rat, mouse, and human samples.
- Aufreinigung
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogen
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3
- Isotyp
- IgG
- Top Product
- Discover our top product CLCN3 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
- Konzentration
- 0.8 mg/mL
- Buffer
- Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- RT,4 °C,-20 °C
- Informationen zur Lagerung
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Target
- CLCN3 (Chloride Channel 3 (CLCN3))
- Andere Bezeichnung
- CLC-3 (CLCN3) (CLCN3 Produkte)
- Synonyme
- CLC3 antikoerper, ClC-3 antikoerper, Clc3 antikoerper, CLCN3 antikoerper, fb78c02 antikoerper, wu:fb78c02 antikoerper, clc3 antikoerper, clc-3 antikoerper, chloride voltage-gated channel 3 antikoerper, chloride channel, voltage-sensitive 3 antikoerper, chloride channel 3 antikoerper, chloride channel protein 3 antikoerper, chloride channel, voltage-sensitive 3 S homeolog antikoerper, CLCN3 antikoerper, Clcn3 antikoerper, clcn3 antikoerper, PTRG_03131 antikoerper, BDBG_05668 antikoerper, MCYG_04420 antikoerper, clcn3.S antikoerper
- Hintergrund
- Alternative names: CLC-3 (CLCN3), Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3
- Gen-ID
- 84360
- NCBI Accession
- NM_001243372
- UniProt
- P51792
-