Peptide YY Antikörper
-
- Target Alle Peptide YY (PYY) Antikörper anzeigen
- Peptide YY (PYY)
-
Reaktivität
- Diverse Spezies
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Peptide YY Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- Recognizes PYY in a wide range of species.
- Produktmerkmale
- Peptide YY| PYY,Peptide tyrosine tyrosine polyclonal antibody
- Aufreinigung
- Whole rabbit serum.
- Immunogen
- Natural pig PYY (peptide with tyrosine, HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.).
- Top Product
- Discover our top product PYY Primärantikörper
-
-
- Applikationshinweise
- Western Blot (1:1,000, ECL)Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- Liquid. Antiserum containing 10 mM sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid freeze/thaw cycles.
- Lagerung
- -20 °C
-
- Target
- Peptide YY (PYY)
- Andere Bezeichnung
- Peptide tyrosine tyrosine (PYY Produkte)
- Synonyme
- PYY-I antikoerper, PYY1 antikoerper, GHYY antikoerper, RATGHYY antikoerper, Yy antikoerper, peptide-YY antikoerper, peptide YY antikoerper, peptide YY (mapped) antikoerper, PYY antikoerper, Pyy antikoerper
- UniProt
- P68005
-