PPP1R8 Antikörper
-
- Target Alle PPP1R8 Antikörper anzeigen
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
-
Reaktivität
- Archaeoprepona
-
Wirt
- Ziege
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP1R8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Kreuzreaktivität (Details)
- Archeoprepona genus
- Aufreinigung
- Epitope affinity purified
- Immunogen
- Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli
- Isotyp
- IgG
- Top Product
- Discover our top product PPP1R8 Primärantikörper
-
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 1-209) antibody
PPP1R8 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 1G11 unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 1-209) antibodyPPP1R8 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 28-127) antibodyPPP1R8 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 4B5 unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (C-Term) antibodyVerified PPP1R8 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 21-120) antibodyPPP1R8 Reaktivität: Maus, Zebrafisch (Danio rerio) WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 71-120) antibodyPPP1R8 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen, Affe, Schwein, Fledermaus, Hamster, Xenopus laevis, Huhn WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) antibodyPPP1R8 Reaktivität: Human, Maus, Ratte, Hund WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (N-Term) antibodyPPP1R8 Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (Internal Region) antibodyPPP1R8 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 91-140) antibodyPPP1R8 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen, Affe, Schwein, Fledermaus, Hamster, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- WB:1:500-1:2,000
- Kommentare
-
Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Konzentration
- 2 mg/mL
- Buffer
- PBS, 20 % glycerol and 0.05 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Store at -20 °C for long-term storage. Store at 2-8 °C for up to one month.
-
- Target
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
- Andere Bezeichnung
- ARD1 (PPP1R8 Produkte)
- Synonyme
- ARD-1 antikoerper, ARD1 antikoerper, NIPP-1 antikoerper, NIPP1 antikoerper, PRO2047 antikoerper, 6330548N22Rik antikoerper, AU044684 antikoerper, PPP1R8 antikoerper, ard-1 antikoerper, ard1 antikoerper, nipp-1 antikoerper, nipp1 antikoerper, ppp1r8 antikoerper, si:ch211-206a7.1 antikoerper, protein phosphatase 1 regulatory subunit 8 antikoerper, protein phosphatase 1, regulatory subunit 8 antikoerper, protein phosphatase 1, regulatory (inhibitor) subunit 8 antikoerper, protein phosphatase 1, regulatory subunit 8b antikoerper, protein phosphatase 1 regulatory subunit 8 L homeolog antikoerper, protein phosphatase 1, regulatory subunit 8a antikoerper, protein phosphatase 1 regulatory subunit 8 S homeolog antikoerper, PPP1R8 antikoerper, Ppp1r8 antikoerper, ppp1r8b antikoerper, ppp1r8.L antikoerper, ppp1r8a antikoerper, ppp1r8.S antikoerper
-
