ITGA3 Antikörper (Cytoplasmic Domain)

Produktnummer ABIN959436

Produktdetails anti-ITGA3 Antikörper

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Bindungsspezifität: Cytoplasmic Domain

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ITGA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Spezifität: Recognizes specifically the cytoplasmic domain of integrin subunit alpha-3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.

Aufreinigung: Purified

Immunogen: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin

Type of Immunogen: Synthetic peptide

Klon: 29A3

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)

Not recommended for: IHC-P

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: PBS containing 0.09 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles. Store undiluted.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.

Details zu ITGA3

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Andere Bezeichnung: ITGA3 / CD49c (ITGA3 Produkte)

Synonyme: CD49C antikoerper, GAP-B3 antikoerper, GAPB3 antikoerper, ILNEB antikoerper, MSK18 antikoerper, VCA-2 antikoerper, VL3A antikoerper, VLA3a antikoerper, ITGA3 antikoerper, AA407068 antikoerper, integrin subunit alpha 3 antikoerper, integrin subunit alpha 3 S homeolog antikoerper, integrin alpha 3 antikoerper, ITGA3 antikoerper, itga3.S antikoerper, Itga3 antikoerper

Hintergrund: Name/Gene ID: ITGA3
Family: Integrin

Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18

Gen-ID: 3675

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex