ITGA3 Antikörper (Cytoplasmic Domain)
-
- Target Alle ITGA3 Antikörper anzeigen
- ITGA3 (Integrin, alpha 3 (ITGA3))
-
Bindungsspezifität
- Cytoplasmic Domain
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser ITGA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Spezifität
- Recognizes specifically the cytoplasmic domain of integrin subunit alpha-3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.
- Aufreinigung
- Purified
- Immunogen
-
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
Type of Immunogen: Synthetic peptide - Klon
- 29A3
- Isotyp
- IgG1
- Top Product
- Discover our top product ITGA3 Primärantikörper
-
-
- Applikationshinweise
-
Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)
Not recommended for: IHC-P - Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- PBS containing 0.09 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- avoid freeze thaw cycles. Store undiluted.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.
-
- Target
- ITGA3 (Integrin, alpha 3 (ITGA3))
- Andere Bezeichnung
- ITGA3 / CD49c (ITGA3 Produkte)
- Synonyme
- CD49C antikoerper, GAP-B3 antikoerper, GAPB3 antikoerper, ILNEB antikoerper, MSK18 antikoerper, VCA-2 antikoerper, VL3A antikoerper, VLA3a antikoerper, ITGA3 antikoerper, AA407068 antikoerper, integrin subunit alpha 3 antikoerper, integrin subunit alpha 3 S homeolog antikoerper, integrin alpha 3 antikoerper, ITGA3 antikoerper, itga3.S antikoerper, Itga3 antikoerper
- Hintergrund
-
Name/Gene ID: ITGA3
Family: Integrin
Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18 - Gen-ID
- 3675
- UniProt
- P26006
- Pathways
- CXCR4-mediated Signaling Events, Integrin Complex
-