ITGA3 Antikörper (Cytoplasmic Domain)
-
- Target Alle ITGA3 Antikörper anzeigen
- ITGA3 (Integrin, alpha 3 (ITGA3))
-
Bindungsspezifität
- Cytoplasmic Domain
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser ITGA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunocytochemistry (ICC)
- Spezifität
- Recognizes specifically the cytoplasmic domain of integrin subunit alpha-3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.
- Aufreinigung
- Purified
- Immunogen
-
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
Type of Immunogen: Synthetic peptide - Klon
- 29A3
- Isotyp
- IgG1
- Top Product
- Discover our top product ITGA3 Primärantikörper
-
anti-Integrin, alpha 3 (ITGA3) (AA 33-236) antibody
ITGA3 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 63-248) antibodyITGA3 Reaktivität: Human ELISA, FACS Wirt: Maus Monoclonal 7H2A11 unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 976-1025) antibodyITGA3 Reaktivität: Maus, Schwein WB, ELISA, FACS, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) antibodyITGA3 Reaktivität: Human, Maus WB, ELISA, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 168-276) antibodyITGA3 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (Internal Region) antibodyITGA3 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 165-199), (N-Term) antibodyITGA3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB52792 unconjugated
anti-Integrin, alpha 3 (ITGA3) antibodyITGA3 Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (Internal Region) antibodyITGA3 Reaktivität: Human, Affe IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (Cytoplasmic Domain) antibodyITGA3 Reaktivität: Human WB, IHC, IHC (fro), ICC Wirt: Maus Monoclonal 158A3 unconjugated
-
- Applikationshinweise
-
Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)
Not recommended for: IHC-P - Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- PBS containing 0.09 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- avoid freeze thaw cycles. Store undiluted.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.
-
- Target
- ITGA3 (Integrin, alpha 3 (ITGA3))
- Andere Bezeichnung
- ITGA3 / CD49c (ITGA3 Produkte)
- Hintergrund
-
Name/Gene ID: ITGA3
Family: Integrin
Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18 - Gen-ID
- 3675
- UniProt
- P26006
- Pathways
- CXCR4-mediated Signaling Events, Integrin Complex
-
