GREM1 Protein
-
- Target Alle GREM1 Proteine anzeigen
- GREM1 (Gremlin 1 (GREM1))
- Protein-Typ
- Recombinant
-
Spezies
- Maus
-
Quelle
- Escherichia coli (E. coli)
- Sequenz
- MKKKGSQGAIPPPDKAQHNDSEQTQSPPQPGSRTRGRGQG RGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTI HEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSF CKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL D
- Produktmerkmale
-
Length (AA): 161
Chromosomal location: 2 E4, 2 64.5 cM - Reinheit
- > 95 % by SDS-PAGE. Visualized by silver stain
- Top Product
- Discover our top product GREM1 Protein
-
-
- Applikationshinweise
- No biological data available at the moment.
- Kommentare
-
Cytokines & Growth Factors
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Mouse Grem-1 should be reconstituted in 50 mM acetic acid or water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions or stored at -20 °C.
- Buffer
- 50 mM acetic acid
- Lagerung
- 0 °C
- Informationen zur Lagerung
- The lyophilized mouse Grem-1, though stable at room temperature, is best stored desiccated below 0 °C
-
- Target
- GREM1 (Gremlin 1 (GREM1))
- Andere Bezeichnung
- Gremlin-1 (GREM1 Produkte)
- Synonyme
- grem1 Protein, MGC136702 Protein, zgc:136702 Protein, GREM1 Protein, drm Protein, pig2 Protein, dand2 Protein, ihg-2 Protein, gremlin Protein, Cktsf1b1 Protein, Drm Protein, Grem Protein, ld Protein, gremlin-1 Protein, CKTSF1B1 Protein, DAND2 Protein, DRM Protein, GREMLIN Protein, IHG-2 Protein, cktsf1b1 Protein, gremlin 1a, DAN family BMP antagonist Protein, gremlin 1, DAN family BMP antagonist Protein, gremlin 1 Protein, gremlin 1, DAN family BMP antagonist L homeolog Protein, grem1a Protein, GREM1 Protein, LOC662541 Protein, grem1 Protein, Grem1 Protein, grem1.L Protein
- Hintergrund
-
Gremlin was identified in a Xenopus expression cloning screen as a dorsalizing factor that can induce a secondary axis. A rat homolog, called Drm, was identified as a cDNA that was down regulated in v Mos transfected cells. Gremlin/Drm belongs to the DAN family of secreted glycoproteins that are BMP antagonists. Other members of the family include: Cerberus, Dante, PRDC, Caronte and DAN. DAN family members share a cysteine-rich domain that is structurally related to the cysteine-knot motif found in TGFβ superfamily ligands. In vitro, Gremlin/Drm binds BMP4 and BMP2 indicating that it might interfere with BMP signaling. Gremlin/Drm acts as a BMP2/ 4 antagonist in a variety of tissues and developmental processes including: Xenopus animal cap explants, chick limb bud outgrowth and chondrogenesis, murine lung branching morphogenesis, and osteogenic differentiation of mouse myoblasts and bone marrow stromal cells. In addition, expression of Gremlin/Drm has been shown to be down-regulated in a wide range of human cancer cell lines. Mouse, human, chick and Xenopus homologs of Gremlin share over 80 % amino acid identity. It is likely that various DAN family members and other BMP antagonists including Noggin, Chordin, Follistatin and TSG can selectively antagonize the activities of different subsets of TGFβ superfamily ligands.
Synonyms: Grem1, ld, Drm, Cktsf1b1 - Molekulargewicht
- 20.7 kDa
- NCBI Accession
- NM_011824, NP_035954
- UniProt
- O70326
- Pathways
- Regulation of Muscle Cell Differentiation, Tube Formation, Maintenance of Protein Location
-