VAPB Protein (AA 1-222) (His tag)

Produktnummer ABIN667277

Produktdetails

Target: VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C (VAPB))

Protein-Typ: Recombinant

Proteineigenschaft: AA 1-222

Spezies: Human

Quelle: Escherichia coli (E. coli)

Aufreinigungstag / Konjugat: Dieses VAPB Protein ist gelabelt mit His tag.

Applikation: SDS-PAGE (SDS)

Sequenz: MGSSHHHHHHSSGLVPRGSHMAKVEQVLSLEPQHELKFRG PFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI IDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTS DMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKI ISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV QRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGL ST

Produktmerkmale: VAPB, 1-222aa, Human, His tag, E.coli

Reinheit: > 90 % by SDS - PAGE

Anwendungsinformationen

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1.0 mg/ml (determined by Bradford assay)

Buffer: Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol

Lagerung: 4 °C

Antigendetails

Target: VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C (VAPB))

Andere Bezeichnung: VAPB (VAPB Produkte)

Synonyme: ALS8 Protein, VAMP-B Protein, VAP-B Protein, AI225786 Protein, AI840687 Protein, AI848259 Protein, D2Abb2e Protein, R75548 Protein, VAP33b Protein, Vamp33b Protein, fc05d09 Protein, wu:fa96d05 Protein, wu:fc05d09 Protein, zgc:66045 Protein, vamp-b Protein, vamp-c Protein, vap-b Protein, vap-c Protein, vapb Protein, VAMP associated protein B and C Protein, vesicle-associated membrane protein-associated protein B/C Protein, vesicle-associated membrane protein, associated protein B and C Protein, VAMP (vesicle-associated membrane protein)-associated protein B and C Protein, VAMP (vesicle-associated membrane protein)-associated protein B and C L homeolog Protein, VAPB Protein, Tsp_07972 Protein, Vapb Protein, vapb Protein, vapb.L Protein

Hintergrund: VAPB, also known as vesicle-associated membrane protein (VAMP)-associated protein B, is a type IV transmembrane protein and member of the VAP family of proteins. This protein may play a role in vesicle trafficking. It is found in plasma and intracellular vesicle membranes as a homodimer and heterodimer with VAPA, and interacts with VAMP1 and VAMP2. Defects in VAPB are a cause of amyotrophic lateral sclerosis type 8 and spinal muscular atrophy autosomal dominant Finkel type. Recombinant human VAPB protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography. Synonyms: Vesicle-associated membrane protein-associated protein B/C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C. NCBI no.: NP_004729

Molekulargewicht: 27.1 kDa (242aa) confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)

Pathways: ER-Nucleus Signaling