ENO2/NSE Protein (AA 2-285) (His tag)
-
- Target Alle ENO2/NSE (ENO2) Proteine anzeigen
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Protein-Typ
- Recombinant
- Proteineigenschaft
- AA 2-285
-
Spezies
- Human
-
Quelle
- Escherichia coli (E. coli)
- Aufreinigungstag / Konjugat
- Dieses ENO2/NSE Protein ist gelabelt mit His tag.
- Applikation
- Western Blotting (WB), SDS-PAGE (SDS), Positive Control (PC), Immunogen (Imm)
- Sequenz
- Ser2-Leu285+TILWSPLRTH LTRMIGLPGP SSQPCRDPDC GVMT
- Produktmerkmale
- Recombinant Enolase, Neuron Specific (NSE), Prokaryotic expression, Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT, N-terminal His Tag
- Reinheit
- > 97 %
- Top Product
- Discover our top product ENO2 Protein
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Isoelectric Point:5.1
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Buffer
- PBS, pH 7.4, containing 0.01 % SKL, 1 mM DTT, 5 % Trehalose and Proclin300.
- Konservierungsmittel
- ProClin
- Vorsichtsmaßnahmen
- This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-80 °C
- Informationen zur Lagerung
- Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
- Haltbarkeit
- 12 months
-
- Target
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Andere Bezeichnung
- Enolase, Neuron Specific (ENO2 Produkte)
- Synonyme
- ENO2 Protein, DKFZp459B1817 Protein, NSE Protein, AI837106 Protein, D6Ertd375e Protein, Eno-2 Protein, RNEN3 Protein, eno3 Protein, wu:fc09h05 Protein, zgc:92418 Protein, enolase 2 Protein, enolase 2 (gamma, neuronal) Protein, enolase 2, gamma neuronal Protein, enolase 2, gamma, neuronal Protein, ENO2 Protein, Eno2 Protein, eno2 Protein
- Hintergrund
- ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
- UniProt
- P09104
-